PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Niben101Scf03309g08007.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family Dof
Protein Properties Length: 171aa    MW: 19048.3 Da    PI: 8.413
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Niben101Scf03309g08007.1genomeBTI-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof123.28.9e-3955112259
                    zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknk 59 
                               ++k+++cprC+s++tkfCy+nny+++qPr+fCk+C+ryWt+GGalrnvPvG+grrk k
  Niben101Scf03309g08007.1  55 PDKIIPCPRCKSMETKFCYFNNYNVNQPRHFCKGCQRYWTAGGALRNVPVGAGRRKAK 112
                               7899****************************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074783.0E-2954112IPR003851Zinc finger, Dof-type
PfamPF027014.4E-3257112IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.25859113IPR003851Zinc finger, Dof-type
PROSITE patternPS0136106197IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0045892Biological Processnegative regulation of transcription, DNA-templated
GO:1902455Biological Processnegative regulation of stem cell population maintenance
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 171 aa     Download sequence    Send to blast
MAQVQENRIS QGIKLFGATI QVQAKQAAKG HDHHPPNKVD DRHDHDIDED QEKKPDKIIP  60
CPRCKSMETK FCYFNNYNVN QPRHFCKGCQ RYWTAGGALR NVPVGAGRRK AKPPCGGSDG  120
DMAAGLSDGC FFDVTNHGNI HQLDFDGVVA EEWHLFPAAK RRRSTSGSQS C
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009794806.11e-119PREDICTED: dof zinc finger protein DOF1.5-like
RefseqXP_016492835.11e-119PREDICTED: dof zinc finger protein DOF1.5-like
SwissprotO229673e-53CDF4_ARATH; Cyclic dof factor 4
TrEMBLM1DDW07e-83M1DDW0_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000874582e-82(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA72402232
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G34140.15e-53Dof family protein